Acta Scientiarum Polonorum Technologia Alimentaria

ISSN:1644-0730, e-ISSN:1898-9594

Acta Scientiarum Polonorum Logo
Submit manuscript
Journal metrics
Indexed in:
Creative Commons licence CC BY-NC (Attribution-NonCommercial)
Issue 12 (1) 2013 pp. 101-111

Marta Dziuba, Piotr Minkiewicz and Marianna Dąbek

Chair of Food Biochemistry, University of Warmia and Mazury in Olsztyn, Poland

Peptides, specific proteolysis products, as molecular markers of allergenic proteins – in silico studies


The objective of this study was to analyse allergenic proteins by identifying their molecular biomarkers for detection in food using bioinformatics tools. The protein and epitope sequences were from BIOPEP database, proteolysis was simulated using BIOPEP program and UniProt database screening via BLAST and FASTA programs. The biomarkers of food proteins were proposed: for example for whey proteins – TPEVDDEALEKFDKALKALPMHIR (β-Lg: fragment 141-164), chicken egg – AAVSVDCSEYPKPDCTAEDRPL (ovomucoid: 156-177), wheat – KCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPY (triose phosphate
isomerase: 12-46) and peanuts – QARQLKNNNPFKFFVPPFQQSPRAVA (arachin: 505-530). The results are annotated in the BIOPEP database of allergenic proteins and epitopes, available at The epitope-receptor interactions are attributed to the epitope’s sequence and suggest that in silico proteolysis products showing the highest degree of sequence identity with an epitope or its part are characteristic of a given protein or a group of cross-reactive homologs. The protein markers from basic food groups were proposed based on the above assumption.

Keywords: allergens, biomarkers, database of allergenic proteins, proteolysis simulation, sequence analysis, in silico analysis
pub/.pdf Full text available in english in Adobe Acrobat format:

For citation:

MLA Dziuba, Marta, and Piotr Minkiewicz and Marianna Dąbek. "Peptides, specific proteolysis products, as molecular markers of allergenic proteins – in silico studies." Acta Sci.Pol. Technol. Aliment. 12.1 (2013): 101-111.
APA Dziuba M., Minkiewicz P., Dąbek M., (2013). Peptides, specific proteolysis products, as molecular markers of allergenic proteins – in silico studies. Acta Sci.Pol. Technol. Aliment. 12 (1), 101-111
ISO 690 DZIUBA, Marta, DąBEK, Piotr Minkiewicz and Marianna. Peptides, specific proteolysis products, as molecular markers of allergenic proteins – in silico studies. Acta Sci.Pol. Technol. Aliment., 2013, 12.1: 101-111.